SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O94811 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O94811
Domain Number 1 Region: 46-179
Classification Level Classification E-value
Superfamily EF-hand 1.96e-46
Family p25-alpha 0.0000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O94811
Sequence length 219
Comment (sp|O94811|TPPP_HUMAN) p25-alpha KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TPPP; OC=Catarrhini; Hominidae; Homo.
Sequence
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAV
HGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEAL
EELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERF
DPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Download sequence
Identical sequences O94811 Q4L233
ENSP00000353785 ENSP00000353785 9606.ENSP00000353785 ENSP00000353785 gi|5902018|ref|NP_008961.1| NP_008961.1.87134 NP_008961.1.92137 XP_005248294.2.92137 XP_016864483.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]