SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O94829 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O94829
Domain Number 1 Region: 58-566,682-736,781-809,860-960
Classification Level Classification E-value
Superfamily ARM repeat 9.25e-130
Family Exportin HEAT-like repeat 0.087
Further Details:      
 
Domain Number 2 Region: 459-806
Classification Level Classification E-value
Superfamily CATH 2.95e-48
Family CATH 0.027
Further Details:      
 
Domain Number 3 Region: 24-339
Classification Level Classification E-value
Superfamily CATH 4.8e-39
Family CATH 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O94829
Sequence length 963
Comment (sp|O94829|IPO13_HUMAN) Ran-binding protein 13 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IPO13; OC=Catarrhini; Hominidae; Homo.
Sequence
MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWH
FSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVL
TRLCVALASLALSMMPDAWPCAVADMVRLFQAEDSPVDGQGRCLALLELLTVLPEEFQTS
RLPQYRKGLVRTSLAVECGAVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCE
ALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNG
DMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHYPVNETTSSLT
LTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQF
RIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETI
DVNYSDVVPGLIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGN
PELSVSSVSTLKKICRECKYDLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSA
LQVEEILKNLHSLISPYIQQLEKLAEEIPNPSNKLAIVHILGLLSNLFTTLDISHHEDDH
EGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQVVEAVCAIFEKSVKTLLDDF
APMVPQLCEMLGRMYSTIPQASALDLTRQLVHIFAHEPAHFPPIEALFLLVTSVTLTLFQ
QGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKAVFQCAVLALKFPEAPTVKASCGF
FTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLL
SMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYT
ADY
Download sequence
Identical sequences A0A096N9D4 A0A0D9S7I5 A0A2J8SM56 A0A2K5NHN3 A0A2K6AKM1 A0A2K6DPP7 A0A2K6N263 A0A2K6QSU7 G3RJT7 G7MGL9 G7NUX7 K6ZEM4 O94829
ENSGGOP00000015984 ENSPANP00000009251 gi|224831257|ref|NP_055467.3| 2x19_B 2xwu_B 3zjy_B 3zjy_E 3zjy_G ENSP00000361418 NP_055467.3.87134 NP_055467.3.92137 XP_003812873.1.60992 XP_004025703.1.27298 XP_005543692.1.63531 XP_007977265.1.81039 XP_010370199.1.97406 XP_011762177.1.29376 XP_011857208.1.47321 XP_011934442.1.92194 XP_014993152.1.72884 XP_016816441.1.37143 XP_017737373.1.44346 ENSP00000361414 ENSP00000361418 9606.ENSP00000361418 ENSGGOP00000015984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]