SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O94923 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  O94923
Domain Number - Region: 394-549
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0218
Family Cellulases catalytic domain 0.076
Further Details:      
 
Domain Number - Region: 515-613
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.0719
Family Class I alpha-1;2-mannosidase, catalytic domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O94923
Sequence length 617
Comment (sp|O94923|GLCE_HUMAN) Heparosan-N-sulfate-glucuronate 5-epimerase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GLCE; OC=Catarrhini; Hominidae; Homo.
Sequence
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASE
SNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGR
REGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGY
NVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAE
DRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQLGNTKDFIISFDLKF
LTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTVTRDLVTDLRK
GVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKG
GWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFL
SEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYER
GMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKE
FVKRWKSYLKGSRAKHN
Download sequence
Identical sequences O94923
NP_001311022.1.87134 NP_001311022.1.92137 NP_001311023.1.87134 NP_001311023.1.92137 NP_056369.1.87134 NP_056369.1.92137 XP_005254355.1.92137 ENSP00000261858 ENSP00000261858 ENSP00000261858 gi|51317380|ref|NP_056369.1| 9606.ENSP00000261858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]