SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O95201 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O95201
Domain Number 1 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 306-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 118-168
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000968
Family KRAB domain (Kruppel-associated box) 0.0033
Further Details:      
 
Domain Number 6 Region: 391-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000439
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O95201
Sequence length 554
Comment (sp|O95201|ZN205_HUMAN) Zinc finger protein 210 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF205; OC=Catarrhini; Hominidae; Homo.
Sequence
MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEG
ASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEA
SGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAA
CGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPD
SEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGA
AAAGALATPPPAPT
Download sequence
Identical sequences O95201
gi|109452593|ref|NP_003447.2| gi|109452595|ref|NP_001035893.1| ENSP00000219091 ENSP00000371627 ENSP00000480401 ENSP00000219091 ENSP00000219091 ENSP00000371627 NP_001035893.1.87134 NP_001035893.1.92137 NP_001265087.1.87134 NP_001265087.1.92137 NP_003447.2.87134 NP_003447.2.92137 XP_005255615.1.92137 9606.ENSP00000219091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]