SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O95222 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O95222
Domain Number 1 Region: 1-317
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.2e-81
Family Rhodopsin-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.428 73.38
cilium 1.675 18.22
ciliary part 1.819 15.9
receptor complex 1.469 9.53
cell body 1.534 9.34
endosome 1.351 7.79
membrane region 1.565 6.09
membrane raft 2.03 6.09
dendrite 1.582 5.8
organelle envelope 1.405 5.73

Protein sequence

External link(s) O95222
Sequence length 327
Comment (sp|O95222|OR6A2_HUMAN) hP2 olfactory receptor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR6A2; OC=Catarrhini; Hominidae; Homo.
Sequence
MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAIRNHSTLHKPM
YFFLANMSFLEIWYVTVTIPKMLAGFVGSKQDHGQLISFEGCMTQLYFFLGLGCTECVLL
AVMAYDRYMAICYPLHYPVIVSGRLCVQMAAGSWAGGFGISMVKVFLISGLSYCGPNIIN
HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRY
KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ
EVKRALCCTLHLYQHQDPDPKKASRNV
Download sequence
Identical sequences A0A126GW91 O95222
ENSP00000330384 gi|34330168|ref|NP_003687.2| 9606.ENSP00000330384 ENSP00000330384 ENSP00000330384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]