SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O95872 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O95872
Domain Number 1 Region: 98-198
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000176
Family Ankyrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O95872
Sequence length 356
Comment (sp|O95872|GPAN1_HUMAN) Protein G5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPANK1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSRPLLITFTPATDPSDLWKDGQQQPQPEKPESTLDGAAARAFYEALIGDESSAPDSQRS
QTEPARERKRKKRRIMKAPAAEAVAEGASGRHGQGRSLEAEDKMTHRILRAAQEGDLPEL
RRLLEPHEAGGAGGNINARDAFWWTPLMCAARAGQGAAVSYLLGRGAAWVGVCELSGRDA
AQLAEEAGFPEVARMVRESHGETRSPENRSPTPSLQYCENCDTHFQDSNHRTSTAHLLSL
SQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRS
APQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRTYMNLEF
Download sequence
Identical sequences A0A024RCU2 O95872
gi|15042961|ref|NP_149417.1| gi|312839866|ref|NP_001186166.1| gi|312839869|ref|NP_001186167.1| gi|312839871|ref|NP_001186168.1| gi|312839873|ref|NP_001186169.1| ENSP00000365057 ENSP00000365059 ENSP00000365060 ENSP00000365065 ENSP00000365071 ENSP00000390746 ENSP00000393567 ENSP00000399890 ENSP00000401376 ENSP00000409206 ENSP00000410690 ENSP00000411691 ENSP00000412321 ENSP00000412884 ENSP00000415855 9606.ENSP00000365057 9606.ENSP00000390746 9606.ENSP00000412884 NP_001186166.1.87134 NP_001186166.1.92137 NP_001186167.1.87134 NP_001186167.1.92137 NP_001186168.1.87134 NP_001186168.1.92137 NP_001186169.1.87134 NP_001186169.1.92137 NP_149417.1.87134 NP_149417.1.92137 XP_005249460.1.92137 XP_006715267.1.92137 XP_011513211.1.92137 XP_011513212.1.92137 ENSP00000365057 ENSP00000365059 ENSP00000365060 ENSP00000365065 ENSP00000365071 ENSP00000390746 ENSP00000393567 ENSP00000399890 ENSP00000401376 ENSP00000409206 ENSP00000410690 ENSP00000411691 ENSP00000412321 ENSP00000412884 ENSP00000415855 ENSP00000365057 ENSP00000387492 ENSP00000393162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]