SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O96018 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O96018
Domain Number 1 Region: 213-358
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-46
Family Phosphotyrosine-binding domain (PTB) 0.00000275
Further Details:      
 
Domain Number 2 Region: 380-490
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-19
Family PDZ domain 0.00021
Further Details:      
 
Domain Number 3 Region: 484-567
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-16
Family PDZ domain 0.0000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O96018
Sequence length 575
Comment (sp|O96018|APBA3_HUMAN) Neuronal Munc18-1-interacting protein 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=APBA3; OC=Catarrhini; Hominidae; Homo.
Sequence
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQEL
VQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEE
CPPSQTGPEEPLEPAPRLLQPPEDPDEDSDSPEWVEGASAEQEGSRSSSSSPEPWLETVP
LVTPEEPPAGAQSPETLASYPAPQEVPGPCDHEDLLDGVIFGARYLGSTQLVSERNPPTS
TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRIKVLTADSQEAMMDHALHTISYTADI
GCVLVLMARRRLARRPAPQDHGRRLYKMLCHVFYAEDAQLIAQAIGQAFAAAYSQFLRES
GIDPSQVGVHPSPGACHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVESGWGSLLPT
AVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVRETKSQTSVTLSIVHC
PPVTTAIIHRPHAREQLGFCVEDGIICSLLRGGIAERGGIRVGHRIIEINGQSVVATPHA
RIIELLTEAYGEVHIKTMPAATYRLLTGQEQPVYL
Download sequence
Identical sequences O96018
ENSP00000315136 9606.ENSP00000315136 ENSP00000315136 NP_004877.1.87134 NP_004877.1.92137 gi|11342678|ref|NP_004877.1| ENSP00000315136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]