SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P01083 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P01083
Domain Number 1 Region: 36-140
Classification Level Classification E-value
Superfamily Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin 1.44e-26
Family Proteinase/alpha-amylase inhibitors 0.0000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P01083
Sequence length 153
Comment (sp|P01083|IAA2_WHEAT) WMAI-1 KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN=IMA1; OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MWMKTVFWGLLVFMLVATTMAVEYGARSHNSGPWSWCNPATGYKVSALTGCRAMVKLQCV
GSQVPEAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVREGKEVLPGCRKEVMKLT
AASVPEVCKVPIPNPSGDRAGVCYGDWAAYPDV
Download sequence
Identical sequences P01083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]