SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P01085 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P01085
Domain Number 1 Region: 6-117
Classification Level Classification E-value
Superfamily Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin 6.32e-32
Family Proteinase/alpha-amylase inhibitors 0.000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P01085
Sequence length 124
Comment (sp|P01085|IAA1_WHEAT) 0.19 alpha-AI KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN= OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSM
LDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA
YPDA
Download sequence
Identical sequences P01085 Q5UHH3 Q5UHH7
cath|current|1hssA00/5-124 cath|current|1hssB00/5-124 cath|current|1hssC00/5-124 cath|current|1hssD00/5-124 1hss.A 1hss.B 1hss.C 1hss.D 1hssA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]