SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P01241 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P01241
Domain Number 1 Region: 28-215
Classification Level Classification E-value
Superfamily 4-helical cytokines 1.91e-67
Family Long-chain cytokines 0.0000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P01241
Sequence length 217
Comment (sp|P01241|SOMA_HUMAN) Pituitary growth hormone KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GH1; OC=Catarrhini; Hominidae; Homo.
Sequence
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Download sequence
Identical sequences B1A4G6 P01241
ENSP00000312673 9606.ENSP00000312673 ENSP00000312673 ENSP00000408486 gi|13027812|ref|NP_000506.2| NP_000506.2.87134 NP_000506.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]