SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P01584 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P01584
Domain Number 1 Region: 122-266
Classification Level Classification E-value
Superfamily Cytokine 2.43e-54
Family Interleukin-1 (IL-1) 0.000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P01584
Sequence length 269
Comment (sp|P01584|IL1B_HUMAN) Catabolin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IL1B; OC=Catarrhini; Hominidae; Homo.
Sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
Download sequence
Identical sequences P01584
NP_000567.1.87134 NP_000567.1.92137 HR4573 ENSP00000263341 9606.ENSP00000263341 ENSP00000263341 ENSP00000263341 gi|10835145|ref|NP_000567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]