SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P02100 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P02100
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 3.98e-55
Family Globins 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P02100
Sequence length 147
Comment (sp|P02100|HBE_HUMAN) Hemoglobin epsilon chain KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HBE1; OC=Catarrhini; Hominidae; Homo.
Sequence
MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK
VKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFG
KEFTPEVQAAWQKLVSAVAIALAHKYH
Download sequence
Identical sequences A0A1K0GUW1 D9YZU7 P02100 Q6LDH0 Q6LDH1
ENSP00000292896 ENSP00000369586 9598.ENSPTRP00000005708 9606.ENSP00000292896 ENSP00000292896 ENSP00000292896 ENSP00000369586 NP_001129304.1.37143 NP_005321.1.87134 NP_005321.1.92137 XP_003819078.1.60992 XP_004050587.1.27298 ENSPTRP00000005708 gi|4885393|ref|NP_005321.1| ENSPTRP00000005708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]