SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P02654 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  P02654
Domain Number - Region: 40-75
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 0.0131
Family Apolipoprotein A-II 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P02654
Sequence length 83
Comment (sp|P02654|APOC1_HUMAN) Truncated apolipoprotein C-I KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=APOC1; OC=Catarrhini; Hominidae; Homo.
Sequence
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
SAKMREWFSETFQKVKEKLKIDS
Download sequence
Identical sequences A0A024R0T8 P02654
ENSP00000465356 ENSP00000468029 9606.ENSP00000252491 NP_001307994.1.87134 NP_001307994.1.92137 NP_001307995.1.87134 NP_001307995.1.92137 NP_001636.1.87134 NP_001636.1.92137 ENSP00000252491 ENSP00000465356 ENSP00000468029 gi|4502157|ref|NP_001636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]