SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P02751 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P02751
Domain Number 1 Region: 1449-1623
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-28
Family Fibronectin type III 0.0000436
Further Details:      
 
Domain Number 2 Region: 1815-1982
Classification Level Classification E-value
Superfamily Fibronectin type III 3.05e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 1269-1438
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-23
Family Fibronectin type III 0.00000677
Further Details:      
 
Domain Number 4 Region: 909-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 2.51e-23
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-21
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 6 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 8 Region: 1634-1805
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-20
Family Fibronectin type III 0.00092
Further Details:      
 
Domain Number 9 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 4.22e-17
Family Fibronectin type III 0.00000236
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000824
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 11 Region: 2249-2292
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000301
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 13 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000314
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 14 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000114
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 15 Region: 472-511
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 16 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000249
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 17 Region: 2204-2247
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000488
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 18 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000602
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000236
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 20 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2292-2333
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000115
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 23 Region: 2118-2182
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000465
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 24 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000187
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P02751
Sequence length 2386
Comment (sp|P02751|FINC_HUMAN) Ugl-Y3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FN1; OC=Catarrhini; Hominidae; Homo.
Sequence
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSD
NAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIA
PRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLL
IGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISV
KWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGE
SQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSA
QWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLT
SRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRT
IKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLL
VSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQ
KSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTS
GQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP
HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLT
GLTRGATYNVIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDE
WERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLG
NGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEP
SPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences P02751
XP_005246463.1.92137 ENSP00000352696 ENSP00000352696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]