SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P02760 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P02760
Domain Number 1 Region: 25-194
Classification Level Classification E-value
Superfamily Lipocalins 1.58e-36
Family Retinol binding protein-like 0.0018
Further Details:      
 
Domain Number 2 Region: 224-283
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0001
Further Details:      
 
Domain Number 3 Region: 286-338
Classification Level Classification E-value
Superfamily BPTI-like 1.06e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P02760
Sequence length 352
Comment (sp|P02760|AMBP_HUMAN) Trypstatin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AMBP; OC=Catarrhini; Hominidae; Homo.
Sequence
MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIM
DRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMES
YVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIF
TMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPC
MGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFI
QLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Download sequence
Identical sequences P02760
gi|4502067|ref|NP_001624.1| NP_001624.1.87134 NP_001624.1.92137 ENSP00000265132 9606.ENSP00000265132 ENSP00000265132 ENSP00000265132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]