SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P03973 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P03973
Domain Number 1 Region: 81-130
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000589
Family Elafin-like 0.00068
Further Details:      
 
Domain Number 2 Region: 29-76
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000955
Family Elafin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P03973
Sequence length 132
Comment (sp|P03973|SLPI_HUMAN) WAP four-disulfide core domain protein 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SLPI; OC=Catarrhini; Hominidae; Homo.
Sequence
MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK
KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG
MCGKSCVSPVKA
Download sequence
Identical sequences P03973
gi|4507065|ref|NP_003055.1| ENSP00000342082 ENSP00000342082 9606.ENSP00000342082 ENSP00000342082 NP_003055.1.87134 NP_003055.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]