SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P04054 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P04054
Domain Number 1 Region: 24-142
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.72e-47
Family Vertebrate phospholipase A2 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P04054
Sequence length 148
Comment (sp|P04054|PA21B_HUMAN) Phosphatidylcholine 2-acylhydrolase 1B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PLA2G1B; OC=Catarrhini; Hominidae; Homo.
Sequence
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
Download sequence
Identical sequences P04054
ENSP00000312286 ENSP00000312286 gi|4505847|ref|NP_000919.1| ENSP00000312286 NP_000919.1.87134 NP_000919.1.92137 9606.ENSP00000312286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]