SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P04090 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P04090
Domain Number 1 Region: 27-64,156-185
Classification Level Classification E-value
Superfamily Insulin-like 0.0000000000000109
Family Insulin-like 0.00049
Further Details:      
 
Weak hits

Sequence:  P04090
Domain Number - Region: 56-129
Classification Level Classification E-value
Superfamily TAFH domain-like 0.00445
Family TAFH domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
enzyme activator activity 1.431 15.76
protease binding 2.073 8.87
kinase activator activity 2.037 7.32
protein kinase regulator activity 1.887 4.59
hormone activity 1.767 4.44
Cellular Component IC (bits) H-Score
extracellular space 1.3 30.35
plasma membrane protein complex 1.527 15.74
cytoplasmic vesicle part 1.417 9.21
vesicle lumen 2.247 7.56
secretory vesicle 1.539 6.52
exocytic vesicle 2.03 4.1

Protein sequence

External link(s) P04090
Sequence length 185
Comment (sp|P04090|REL2_HUMAN) Relaxin A chain KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RLN2; OC=Catarrhini; Hominidae; Homo.
Sequence
MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQE
DAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLK
DSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRS
LARFC
Download sequence
Identical sequences P04090
gi|20143933|ref|NP_604390.1| ENSP00000308018 ENSP00000371040 ENSP00000371040 NYSGRC-20143933 9606.ENSP00000371040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]