SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P04776 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P04776
Domain Number 1 Region: 5-177,217-277,309-480
Classification Level Classification E-value
Superfamily RmlC-like cupins 9.65e-86
Family Germin/Seed storage 7S protein 0.0000000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P04776
Sequence length 495
Comment (sp|P04776|GLYG1_SOYBN) Glycinin Bx subunit KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GY1; OC=Phaseoleae; Glycine; Soja.
Sequence
MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK
PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR
GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR
RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA
KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE
FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV
AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF
KFLVPPQESQKRAVA
Download sequence
Identical sequences A0A0R0KKD6 P04776
Glyma03g32030.1|PACid:16253019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]