SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P05408 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P05408
Sequence length 212
Comment (sp|P05408|7B2_HUMAN) C-terminal peptide KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SCG5; OC=Catarrhini; Hominidae; Homo.
Sequence
MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEY
PAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPC
PVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKR
RSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE
Download sequence
Identical sequences A0A024R9I1 G3RJS1 K7C9U9 P05408
gi|221139785|ref|NP_001138229.1| ENSP00000300175 ENSGGOP00000015967 ENSGGOP00000015967 ENSP00000300175 ENSP00000482615 NP_001138229.1.87134 NP_001138229.1.92137 XP_003805003.1.60992 XP_004055950.1.27298 XP_009426993.1.37143 9598.ENSPTRP00000011732 9606.ENSP00000300175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]