SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P07199 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P07199
Domain Number 1 Region: 539-585
Classification Level Classification E-value
Superfamily Dimerisation domain of CENP-B 3.14e-28
Family Dimerisation domain of CENP-B 0.0000828
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Homeodomain-like 4.66e-17
Family Centromere-binding 0.000059
Further Details:      
 
Domain Number 3 Region: 72-131
Classification Level Classification E-value
Superfamily Homeodomain-like 1.25e-16
Family Centromere-binding 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
protein-DNA complex 1.923 18.12
chromosomal part 1.512 12.74
nucleoplasm part 1.369 11.17
ATPase complex 2.002 11.05
nuclear transcription factor complex 2.016 8.32
chromosomal region 1.996 7.51
transferase complex 1.369 7.08
microtubule cytoskeleton 1.44 5.46
centrosome 2.023 5.46
nuclear chromosome part 1.842 4.92
Biological Process IC (bits) H-Score
endocrine system development 1.681 40.61
cell fate specification 1.993 36.66
cell fate commitment 1.4 33.46
diencephalon development 2.237 30.86
forebrain development 1.469 29.05
endocrine pancreas development 1.998 28.42
pancreas development 1.741 26.94
regulation of cell fate commitment 2.15 24.05
gastrulation 1.536 23.99
regulation of apoptotic process 1.258 22.83

Protein sequence

External link(s) P07199
Sequence length 599
Comment (sp|P07199|CENPB_HUMAN) Centromere protein B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CENPB; OC=Catarrhini; Hominidae; Homo.
Sequence
MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYG
VASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASN
GWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPP
SVAEGYASQDVFSATETSLWYDFLPDQAAGLCGGDGRPRQATQRLSVLLCANADGSEKLP
PLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLA
AQSLDTSGLRHVQLAFFPPGTVHPLERGVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLG
LTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEG
EGEEEEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEEDEESSSEGLEAEDWAQGV
VEAGGSFGAYGAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVP
VPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS
Download sequence
Identical sequences P07199
9606.ENSP00000369075 ENSP00000369075 gi|21735415|ref|NP_001801.1| ENSP00000369075 ENSP00000369075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]