SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P07199 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P07199
Domain Number 1 Region: 539-585
Classification Level Classification E-value
Superfamily Dimerisation domain of CENP-B 3.14e-28
Family Dimerisation domain of CENP-B 0.0000828
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Homeodomain-like 4.66e-17
Family Centromere-binding 0.000059
Further Details:      
 
Domain Number 3 Region: 72-131
Classification Level Classification E-value
Superfamily Homeodomain-like 1.25e-16
Family Centromere-binding 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P07199
Sequence length 599
Comment (sp|P07199|CENPB_HUMAN) Centromere protein B KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CENPB; OC=Catarrhini; Hominidae; Homo.
Sequence
MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYG
VASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASN
GWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPP
SVAEGYASQDVFSATETSLWYDFLPDQAAGLCGGDGRPRQATQRLSVLLCANADGSEKLP
PLVAGKSAKPRAGQAGLPCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLA
AQSLDTSGLRHVQLAFFPPGTVHPLERGVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLG
LTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSLKSEGEEEEEEEEEEEEEEG
EGEEEEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEEDEESSSEGLEAEDWAQGV
VEAGGSFGAYGAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVP
VPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS
Download sequence
Identical sequences P07199
ENSP00000369075 ENSP00000369075 9606.ENSP00000369075 NP_001801.1.87134 NP_001801.1.92137 ENSP00000369075 gi|21735415|ref|NP_001801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]