SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P08138 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P08138
Domain Number 1 Region: 334-419
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-21
Family DEATH domain, DD 0.0000113
Further Details:      
 
Domain Number 2 Region: 85-123
Classification Level Classification E-value
Superfamily TNF receptor-like 1.25e-16
Family TNF receptor-like 0.00014
Further Details:      
 
Domain Number 3 Region: 31-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000279
Family TNF receptor-like 0.0000785
Further Details:      
 
Domain Number 4 Region: 106-165
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000113
Family TNF receptor-like 0.00011
Further Details:      
 
Domain Number 5 Region: 166-189
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000848
Family TNF receptor-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P08138
Sequence length 427
Comment (sp|P08138|TNR16_HUMAN) p75 ICD KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NGFR; OC=Catarrhini; Hominidae; Homo.
Sequence
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
Download sequence
Identical sequences H2QDD4 P08138
gi|4505393|ref|NP_002498.1| ENSP00000172229 ENSP00000172229 9606.ENSP00000172229 NYSGXRC-13055a NP_002498.1.87134 NP_002498.1.92137 XP_003810100.1.60992 XP_016786983.1.37143 ENSP00000172229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]