SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for P09938 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P09938
Domain Number 1 Region: 31-359
Classification Level Classification E-value
Superfamily Ferritin-like 7.57e-113
Family Ribonucleotide reductase-like 0.00000000000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
fusome 2.198 7.62
plastid 1.598 4.9
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P09938
Sequence length 399
Comment (sp|P09938|RIR2_YEAST) Ribonucleotide reductase small subunit 1 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=RNR2 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MPKETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHKAYLK
SHQVHRHKLKEMEKEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIH
DWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHS
ETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEG
VFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIV
TEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENI
SLAGKTNFFEKRVSDYQKAGVMSKSTKQEAGAFTFNEDF
Download sequence
Identical sequences N1NZY1 P09938
ISFI293 YJL026W YJL026W YJL026w___KOG1567 YJL026W YJL026W 4932.YJL026W 1smqA YJL026W 1smq.A 1smq.B 1smq.C 1smq.D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]