SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for P09938 from Uniprot 2014_06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P09938
Domain Number 1 Region: 31-359
Classification Level Classification E-value
Superfamily Ferritin-like 7.57e-113
Family Ribonucleotide reductase-like 6.46e-12
Further Details:      
 

Protein sequence

External link(s) P09938
Sequence length 399
Comment (sp|P09938|RIR2_YEAST) Ribonucleotide reductase small subunit 1 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=RNR2 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MPKETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHKAYLK
SHQVHRHKLKEMEKEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIH
DWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHS
ETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEG
VFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIV
TEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENI
SLAGKTNFFEKRVSDYQKAGVMSKSTKQEAGAFTFNEDF
Download sequence
Identical sequences N1NZY1 P09938
YJL026W 1smqA 4932.YJL026W YJL026W YJL026W YJL026W 1smq.A 1smq.B 1smq.C 1smq.D YJL026w___KOG1567 ISFI293 YJL026W

Jump to [ Top of page · Domain architecture · Domain assignment details ]