SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P0C0S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0C0S8
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily Histone-fold 2.4e-48
Family Nucleosome core histones 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P0C0S8
Sequence length 130
Comment (sp|P0C0S8|H2A1_HUMAN) Histone H2A/ptl KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HIST1H2AM; OC=Catarrhini; Hominidae; Homo.
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
Download sequence
Identical sequences A0A091DTS3 A0A096MZA0 A0A0D9SCK1 A0A1S3GP60 A0A1U7UNX0 A0A286XNK5 A0A287ARN9 A0A2F0AZJ9 A0A2K5C0R5 A0A2K5HGV4 A0A2K5KY15 A0A2K5RKC6 A0A2K5XC31 A0A2K6AMW3 A0A2K6ESE3 A0A2K6JTY2 A0A2K6NCZ4 A0A2K6S1B6 A4FTV9 D2HWJ3 F7B9F5 F7C6M7 F7FGM6 G1Q7Q6 G1S9J2 G1TUJ8 G3RQ76 G3U9A7 G5BSF8 G8F3V0 H0XTB4 H2PI89 H2QSG5 I3MT31 J9P6M9 K9IY72 L5JWK9 L8HPG7 P0C0S8 P0C0S9 S7MRU2 S9W6E5 W5QFN5
ENSOCUP00000015545 ENSOCUP00000016083 ENSOCUP00000019955 ENSOCUP00000020724 ENSPTRP00000030451 ENSPTRP00000030455 ENSPTRP00000042629 ENSPTRP00000050486 ENSSSCP00000019637 ENSSSCP00000025285 ENSSSCP00000027476 gi|10800132|ref|NP_066408.1| gi|4504239|ref|NP_003500.1| gi|4504241|ref|NP_003501.1| gi|4504243|ref|NP_003502.1| gi|4504249|ref|NP_003505.1| ENSCJAP00000034727 ENSECAP00000001117 ENSECAP00000002653 ENSECAP00000004603 ENSOGAP00000014670 ENSOGAP00000019356 ENSBTAP00000014123 ENSBTAP00000033278 ENSBTAP00000033286 ENSBTAP00000033290 ENSBTAP00000042461 ENSBTAP00000042470 ENSBTAP00000052261 ENSMMUP00000034277 ENSMMUP00000034282 ENSMMUP00000034291 ENSMMUP00000034301 ENSLAFP00000022482 ENSLAFP00000023570 ENSLAFP00000024415 ENSLAFP00000028568 ENSNLEP00000022646 ENSNLEP00000022651 ENSNLEP00000022657 ENSNLEP00000022662 ENSCPOP00000014823 ENSCPOP00000015746 ENSCPOP00000015777 ENSCPOP00000016155 ENSCPOP00000017592 ENSCPOP00000020621 ENSCPOP00000021024 ENSNLEP00000022646 ENSNLEP00000022651 ENSNLEP00000022657 ENSNLEP00000022662 ENSMICP00000010829 ENSOCUP00000015545 ENSOCUP00000016083 ENSOCUP00000019955 ENSOCUP00000020724 ENSCJAP00000041051 ENSTBEP00000005079 ENSTBEP00000008420 ENSAMEP00000019548 ENSAMEP00000019599 ENSOARP00000009862 ENSOARP00000009912 ENSOARP00000021504 ENSOARP00000021533 ENSOARP00000021545 ENSMLUP00000015647 ENSMLUP00000016432 ENSMLUP00000016713 ENSMLUP00000016783 ENSMLUP00000017040 ENSMLUP00000018021 ENSMLUP00000019739 ENSMICP00000010829 ENSCPOP00000014823 ENSCPOP00000015746 ENSCPOP00000015777 ENSCPOP00000016155 ENSCPOP00000017592 ENSCPOP00000020621 ENSCPOP00000021024 ENSTBEP00000005079 ENSTBEP00000008420 ENSAMEP00000019548 ENSAMEP00000019599 ENSPTRP00000030451 ENSPTRP00000030455 ENSPTRP00000042629 ENSPTRP00000050486 ENSVPAP00000003980 ENSOPRP00000003128 ENSOPRP00000003308 ENSOPRP00000016098 ENSPVAP00000000718 ENSPVAP00000014484 ENSPVAP00000014491 ENSPVAP00000016615 ENSPANP00000000441 ENSPANP00000005295 ENSPANP00000007129 ENSPANP00000009919 HGL_H00000352627-10 HGL_H00000352627-7 HGL_H00000352627-8 HGL_H00000352627-9 ENSPPYP00000018268 ENSPPYP00000018276 ENSPPYP00000018282 ENSPPYP00000018287 ENSSSCP00000019637 ENSSSCP00000025285 ENSSSCP00000027476 ENSMMUP00000034277 ENSMMUP00000034282 ENSMMUP00000034291 ENSMMUP00000034301 ENSPCAP00000002008 ENSPCAP00000013057 ENSPCAP00000013267 ENSMLUP00000015647 ENSMLUP00000016432 ENSMLUP00000016713 ENSMLUP00000016783 ENSMLUP00000017040 ENSMLUP00000018021 ENSMLUP00000019739 10141.ENSCPOP00000014823 10141.ENSCPOP00000015746 10141.ENSCPOP00000015777 10141.ENSCPOP00000016155 10141.ENSCPOP00000017592 10141.ENSCPOP00000020621 10141.ENSCPOP00000021024 9361.ENSDNOP00000015738 9361.ENSDNOP00000016388 9361.ENSDNOP00000016519 9361.ENSDNOP00000017579 9544.ENSMMUP00000034277 9544.ENSMMUP00000034282 9544.ENSMMUP00000034291 9544.ENSMMUP00000034301 9598.ENSPTRP00000030451 9598.ENSPTRP00000030455 9598.ENSPTRP00000042629 9598.ENSPTRP00000050486 9600.ENSPPYP00000018268 9600.ENSPPYP00000018276 9600.ENSPPYP00000018282 9600.ENSPPYP00000018287 9606.ENSP00000330307 9606.ENSP00000349873 9606.ENSP00000351589 9606.ENSP00000352119 9606.ENSP00000352627 9796.ENSECAP00000001117 9796.ENSECAP00000002653 9796.ENSECAP00000004603 9823.ENSSSCP00000001197 9823.ENSSSCP00000001202 9823.ENSSSCP00000001245 9823.ENSSSCP00000001248 9913.ENSBTAP00000014123 9913.ENSBTAP00000033278 9913.ENSBTAP00000033286 9913.ENSBTAP00000033290 9913.ENSBTAP00000042461 9913.ENSBTAP00000042470 9913.ENSBTAP00000048654 9913.ENSBTAP00000052261 9986.ENSOCUP00000015545 9986.ENSOCUP00000016083 9986.ENSOCUP00000019955 9986.ENSOCUP00000020724 ENSPCAP00000002008 ENSPCAP00000013057 ENSPCAP00000013267 ENSCHOP00000004151 ENSCHOP00000011806 ENSDNOP00000023658 ENSDNOP00000032829 ENSDORP00000004180 ENSDORP00000008209 ENSP00000330307 ENSP00000349873 ENSP00000351589 ENSP00000352119 ENSP00000352627 ENSPPYP00000018268 ENSPPYP00000018276 ENSPPYP00000018282 ENSPPYP00000018287 ENSOPRP00000003128 ENSOPRP00000003308 ENSOPRP00000016098 ENSOGAP00000014670 ENSOGAP00000019356 NP_001092190.1.59421 NP_001092190.1.76553 NP_001180960.1.72884 NP_001273073.1.63531 NP_003500.1.87134 NP_003500.1.92137 NP_003501.1.87134 NP_003501.1.92137 NP_003502.1.87134 NP_003502.1.92137 NP_003505.1.87134 NP_003505.1.92137 NP_066408.1.87134 NP_066408.1.92137 XP_001097227.1.72884 XP_001505083.1.31192 XP_001510747.1.37387 XP_001514280.1.37387 XP_001514488.1.37387 XP_001514612.1.37387 XP_001514712.1.37387 XP_001515330.1.37387 XP_001927727.1.46622 XP_002697551.1.76553 XP_002721661.1.1745 XP_002721666.1.1745 XP_002721670.1.1745 XP_002816596.1.23681 XP_002816616.1.23681 XP_002816621.1.23681 XP_002816624.1.23681 XP_002927131.1.58354 XP_002927135.1.58354 XP_003272010.1.23891 XP_003356618.1.46622 XP_003416459.1.64505 XP_003421156.1.64505 XP_003421192.1.64505 XP_003422330.1.64505 XP_003463256.1.53824 XP_003463258.1.53824 XP_003463265.1.53824 XP_003468837.1.53824 XP_003468846.1.53824 XP_003768759.1.9362 XP_003801907.1.62490 XP_003801912.1.62490 XP_003810987.1.60992 XP_003829733.1.60992 XP_003829739.1.60992 XP_003829742.1.60992 XP_003944780.1.74449 XP_003950810.2.37143 XP_004019081.1.66739 XP_004019082.1.66739 XP_004019095.1.66739 XP_004043488.1.27298 XP_004043512.1.27298 XP_004043516.2.27298 XP_004043522.1.27298 XP_004043524.1.27298 XP_004087105.1.23891 XP_004087108.1.23891 XP_004087109.1.23891 XP_004273535.1.21590 XP_004286152.1.21590 XP_004317747.2.83887 XP_004317754.2.83887 XP_004384087.1.4749 XP_004387123.1.4749 XP_004387126.1.4749 XP_004441823.1.5094 XP_004441829.1.5094 XP_004463568.1.11602 XP_004463572.1.11602 XP_004463578.1.11602 XP_004470315.1.11602 XP_004481900.1.11602 XP_004481904.1.11602 XP_004481906.1.11602 XP_004481909.1.11602 XP_004596553.1.84141 XP_004596560.1.84141 XP_004640159.1.9945 XP_004640167.1.9945 XP_004640169.1.9945 XP_004640179.1.9945 XP_004640181.1.9945 XP_004670882.1.11716 XP_004670891.1.11716 XP_004670894.1.11716 XP_004694907.1.23501 XP_004695481.1.23501 XP_004847592.1.39548 XP_004847598.1.39548 XP_004847600.1.39548 XP_004847874.1.39548 XP_004847876.1.39548 XP_005196697.1.59421 XP_005223785.1.76553 XP_005337120.1.77405 XP_005399008.1.28644 XP_005603691.1.31192 XP_005696864.2.57651 XP_005865312.1.60319 XP_005910269.1.15283 XP_006045702.1.26621 XP_006045705.1.26621 XP_006048080.1.26621 XP_006105755.1.53796 XP_006105763.1.53796 XP_006105899.1.53796 XP_006105900.1.53796 XP_006105904.1.53796 XP_006106486.1.53796 XP_006182227.1.101512 XP_006194223.1.101512 XP_006194226.1.101512 XP_006194229.1.101512 XP_006215324.1.17985 XP_006872843.1.41390 XP_006872846.1.41390 XP_006872853.1.41390 XP_006902698.1.29581 XP_006903271.1.29581 XP_006903435.1.29581 XP_006923513.1.64745 XP_006923533.1.64745 XP_007105886.1.24612 XP_007105897.1.24612 XP_007177442.1.59432 XP_007179124.1.59432 XP_007179135.1.59432 XP_007449305.1.90284 XP_007449314.1.90284 XP_007471284.1.90284 XP_007948031.1.48129 XP_007955074.1.48129 XP_007955077.1.48129 XP_007971588.1.81039 XP_007971595.1.81039 XP_007971600.1.81039 XP_007971616.1.81039 XP_008070420.1.4292 XP_008070421.1.4292 XP_008070428.1.4292 XP_008145281.1.99482 XP_008246690.1.1745 XP_008561647.1.73410 XP_008566076.1.73410 XP_008580151.1.73410 XP_008580154.1.73410 XP_008585849.1.73410 XP_008691203.1.72690 XP_008691206.1.72690 XP_008691226.1.72690 XP_008953274.1.60992 XP_008992031.1.60252 XP_008992058.1.60252 XP_010331118.1.74449 XP_010372518.1.97406 XP_010372543.1.97406 XP_010372563.1.97406 XP_010372591.1.97406 XP_010372766.1.97406 XP_010621312.1.5607 XP_010816763.1.76553 XP_010816815.1.76553 XP_010823700.1.59421 XP_010823710.1.59421 XP_010832332.1.44457 XP_010832337.1.44457 XP_010841722.1.44457 XP_010841729.1.44457 XP_010851428.1.44457 XP_010972447.1.22495 XP_010972452.1.22495 XP_010972458.1.22495 XP_010972488.1.22495 XP_010973012.1.51371 XP_010978486.1.51371 XP_011364660.1.92234 XP_011756516.1.29376 XP_011756524.1.29376 XP_011756532.1.29376 XP_011756557.1.29376 XP_011800316.1.43180 XP_011800318.1.43180 XP_011800319.1.43180 XP_011800327.1.43180 XP_011800340.1.43180 XP_011846598.1.47321 XP_011846631.1.47321 XP_011846640.1.47321 XP_011931478.1.92194 XP_011931481.1.92194 XP_011931489.1.92194 XP_011931507.1.92194 XP_011956520.1.66739 XP_012014265.1.54773 XP_012014274.1.54773 XP_012014277.1.54773 XP_012020690.1.54773 XP_012020738.1.54773 XP_012321303.1.9421 XP_012321305.1.9421 XP_012321306.1.9421 XP_012321307.1.9421 XP_012494064.1.63892 XP_012494065.1.63892 XP_012597450.1.48125 XP_012597451.1.48125 XP_012807211.1.11716 XP_012886711.1.60039 XP_012886736.1.60039 XP_012890663.1.60039 XP_013219116.1.77405 XP_013219129.1.77405 XP_013359246.1.28644 XP_013359247.1.28644 XP_013359248.1.28644 XP_013829519.1.57651 XP_013829522.1.57651 XP_013829523.2.57651 XP_014303296.1.53796 XP_014303408.1.53796 XP_014332610.1.15283 XP_014332612.1.15283 XP_014392553.1.60319 XP_014397409.1.60319 XP_014397410.1.60319 XP_014422720.1.101512 XP_014589772.1.31192 XP_014589773.1.31192 XP_014651785.1.5094 XP_014684668.1.49734 XP_014694461.1.49734 XP_014991239.1.72884 XP_014991251.1.72884 XP_015104244.1.17985 XP_015107250.1.17985 XP_015305249.1.63531 XP_015305250.1.63531 XP_015305252.1.63531 XP_015349637.1.40921 XP_015349638.1.40921 XP_015349639.1.40921 XP_015349696.1.40921 XP_015987459.1.101085 XP_015988057.1.101085 XP_015988609.1.101085 XP_015988721.1.101085 XP_015988822.1.101085 XP_015989022.1.101085 XP_015989032.1.101085 XP_015989038.1.101085 XP_015989374.1.101085 XP_016021798.1.101085 XP_016071759.1.3490 XP_016071760.1.3490 XP_016071761.1.3490 XP_016071762.1.3490 XP_016071763.1.3490 XP_016075777.1.3490 XP_016075778.1.3490 XP_016810562.1.37143 XP_017373973.1.71028 XP_017376848.1.71028 XP_017715472.1.44346 XP_017744636.1.44346 XP_017744639.1.44346 XP_017744655.1.44346 XP_017894032.1.57651 XP_017894033.1.57651 XP_019486818.1.44202 XP_019486819.1.44202 XP_019486820.1.44202 XP_019569743.1.88060 XP_019569745.1.88060 XP_019569746.1.88060 XP_019569747.1.88060 XP_019569748.1.88060 XP_019800700.1.83887 XP_019840852.1.53367 XP_019840855.1.53367 XP_019841103.1.53367 XP_020727355.1.74333 XP_020742254.1.74333 XP_020758578.1.74333 XP_020758603.1.74333 XP_020760084.1.74333 XP_020822462.1.61212 XP_020955497.1.46622 XP_020955498.1.46622 XP_021522428.1.9421 XP_527272.2.37143 XP_527283.2.37143 XP_545419.1.84170 XP_876240.1.59421 ENSBTAP00000014123 ENSBTAP00000033278 ENSBTAP00000033286 ENSBTAP00000033290 ENSBTAP00000042461 ENSBTAP00000042470 ENSBTAP00000052261 ENSVPAP00000003980 ENSCAFP00000041312 ENSP00000351589 ENSP00000352119 ENSP00000352627 ENSP00000482431 ENSP00000482538 ENSDNOP00000015738 ENSDNOP00000016388 ENSDNOP00000016519 ENSDNOP00000017579 ENSLAFP00000022482 ENSLAFP00000023570 ENSLAFP00000024415 ENSLAFP00000028568 ENSTTRP00000000328 ENSTTRP00000012756 ENSTTRP00000012774 ENSTTRP00000014910 ENSGGOP00000001416 ENSGGOP00000001423 ENSGGOP00000016567 ENSGGOP00000018790 ENSCAFP00000041312 ENSSTOP00000015276 ENSSTOP00000015694 ENSSTOP00000022139 ENSDORP00000004180 ENSDORP00000008209 ENSPVAP00000000718 ENSPVAP00000014484 ENSPVAP00000014491 ENSPVAP00000016615 ENSCHOP00000004151 ENSCHOP00000011806 ENSSTOP00000015276 ENSSTOP00000015694 ENSSTOP00000022139 ENSP00000330307 ENSP00000349873 ENSP00000351589 ENSP00000352119 ENSP00000352627 ENSECAP00000001117 ENSECAP00000002653 ENSECAP00000004603 ENSGGOP00000001416 ENSGGOP00000001423 ENSGGOP00000016567 ENSGGOP00000018790 ENSTTRP00000000328 ENSTTRP00000012756 ENSTTRP00000012774 ENSTTRP00000014910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]