SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P0C1H6 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0C1H6
Domain Number 1 Region: 32-142
Classification Level Classification E-value
Superfamily Histone-fold 3.57e-39
Family Nucleosome core histones 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear transcription factor complex 2.016 47.43
protein-DNA complex 1.923 40.48
chromosomal part 1.512 33.06
transferase complex 1.369 32.9
ATPase complex 2.002 23.63
replication fork 2.213 10.99
extracellular space 1.3 10.51
nucleoplasm part 1.369 8.5
methyltransferase complex 2.143 7.64
chromosomal region 1.996 7.41

Protein sequence

External link(s) P0C1H6
Sequence length 154
Comment (sp|P0C1H6|H2BFM_HUMAN) Histone H2B.s KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=H2BFM; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSF
TPYFPRVLKQVHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMA
VRLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK
Download sequence
Identical sequences P0C1H6 W0TYI6
ENSP00000347119 ENSP00000482611 ENSP00000347119 ENSP00000471405 gi|256542317|ref|NP_001157888.1| NP_001157888.1 XP_006724703.1 XP_011529224.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]