SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P0DJD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0DJD8
Domain Number 1 Region: 1-386
Classification Level Classification E-value
Superfamily Acid proteases 4.55e-131
Family Pepsin-like 0.00000000000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P0DJD8
Sequence length 388
Comment (sp|P0DJD8|PEPA3_HUMAN) Pepsinogen-3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PGA3; OC=Catarrhini; Hominidae; Homo.
Sequence
MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWKAP
TLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNP
EDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFD
GILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGS
LNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGAS
ENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGEL
WILGDVFIRQYFTVFDRANNQVGLAPVA
Download sequence
Identical sequences P0DJD8
ENSP00000322192 ENSP00000322192 NP_001073275.1.87134 NP_001073275.1.92137 gi|119372298|ref|NP_001073275.1| 9606.ENSP00000322192 ENSP00000322192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]