SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P0DMS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0DMS8
Domain Number 1 Region: 7-314
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.3e-56
Family Rhodopsin-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P0DMS8
Sequence length 318
Comment (sp|P0DMS8|AA3R_HUMAN) Adenosine receptor A3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ADORA3 OC=Catarrhini; Hominidae; Homo.
Sequence
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Download sequence
Identical sequences P0DMS8
ENSP00000241356 gi|4501953|ref|NP_000668.1| NP_000668.1.87134 NP_000668.1.92137 NP_001289704.1.37143 XP_008961270.1.60992 ENSP00000241356 ATCG3D_38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]