SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P10912 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P10912
Domain Number 1 Region: 50-148
Classification Level Classification E-value
Superfamily Fibronectin type III 2.85e-34
Family Fibronectin type III 0.000000853
Further Details:      
 
Domain Number 2 Region: 149-252
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-19
Family Fibronectin type III 0.000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P10912
Sequence length 638
Comment (sp|P10912|GHR_HUMAN) Serum-binding protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GHR; OC=Catarrhini; Hominidae; Homo.
Sequence
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEES
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHIKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
Download sequence
Identical sequences P10912
ENSP00000230882 NP_000154.1.87134 NP_000154.1.92137 NP_001229329.1.87134 NP_001229329.1.92137 NP_001229330.1.87134 NP_001229330.1.92137 NP_001229331.1.87134 NP_001229331.1.92137 NP_001229332.1.87134 NP_001229332.1.92137 NP_001229333.1.87134 NP_001229333.1.92137 NP_001229334.1.87134 NP_001229334.1.92137 NP_001229335.1.87134 NP_001229335.1.92137 ENSP00000230882 ENSP00000442206 ENSP00000478291 ENSP00000478332 ENSP00000479846 ENSP00000482373 ENSP00000230882 9606.ENSP00000230882 gi|334883129|ref|NP_001229329.1| gi|334883131|ref|NP_001229330.1| gi|334883133|ref|NP_001229331.1| gi|334883135|ref|NP_001229332.1| gi|334883137|ref|NP_001229333.1| gi|334883139|ref|NP_001229334.1| gi|334883141|ref|NP_001229335.1| gi|4503993|ref|NP_000154.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]