SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P11086 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P11086
Domain Number 1 Region: 27-279
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.59e-54
Family Arylamine N-methyltransferase 0.0000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P11086
Sequence length 282
Comment (sp|P11086|PNMT_HUMAN) Noradrenaline N-methyltransferase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PNMT; OC=Catarrhini; Hominidae; Homo.
Sequence
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Download sequence
Identical sequences P11086
ENSP00000377791 9606.ENSP00000269582 NP_002677.1.87134 NP_002677.1.92137 gi|4505921|ref|NP_002677.1| ENSP00000269582 1hnnA cath|current|1hnnB00/514-780 cath|current|1n7iB00/514-780 cath|current|1n7jB00/514-780 ENSP00000269582 1hnn_A 1hnn_B 1n7i_A 1n7i_B 1n7j_A 1n7j_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]