SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P11117 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P11117
Domain Number 1 Region: 33-370
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.65e-103
Family Histidine acid phosphatase 0.00000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P11117
Sequence length 423
Comment (sp|P11117|PPAL_HUMAN) Lysosomal acid phosphatase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ACP2; OC=Catarrhini; Hominidae; Homo.
Sequence
MAGKRSGWSRAALLQLLLGVNLVVMPPTRARSLRFVTLLYRHGDRSPVKTYPKDPYQEEE
WPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAG
LFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESS
RNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSF
RFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVY
NGEQAPYASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRLTEP
VVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLLTVLFRMQAQPPGYRHVADGE
DHA
Download sequence
Identical sequences P11117
9606.ENSP00000256997 ENSP00000256997 NP_001601.1.87134 NP_001601.1.92137 ENSP00000256997 ENSP00000256997 gi|4557010|ref|NP_001601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]