SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P12544 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P12544
Domain Number 1 Region: 29-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.59e-68
Family Eukaryotic proteases 0.00000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P12544
Sequence length 262
Comment (sp|P12544|GRAA_HUMAN) Hanukkah factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GZMA; OC=Catarrhini; Hominidae; Homo.
Sequence
MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIA
KDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL
MEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCN
DRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGP
GVYILLSKKHLNWIIMTIKGAV
Download sequence
Identical sequences P12544
ENSP00000274306 ENSP00000274306 9606.ENSP00000274306 ENSP00000274306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]