SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P13639 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P13639
Domain Number 1 Region: 4-359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.27e-111
Family G proteins 0.00000000244
Further Details:      
 
Domain Number 2 Region: 577-741
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.94e-71
Family Translational machinery components 0.000000844
Further Details:      
 
Domain Number 3 Region: 360-483
Classification Level Classification E-value
Superfamily Translation proteins 3.08e-52
Family Elongation factors 0.0000017
Further Details:      
 
Domain Number 4 Region: 742-826
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.1e-48
Family EF-G/eEF-2 domains III and V 0.00000318
Further Details:      
 
Domain Number 5 Region: 406-488
Classification Level Classification E-value
Superfamily ECOD 2.45e-46
Family ECOD 0.00094
Further Details:      
 
Domain Number 6 Region: 503-575
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.78e-41
Family EF-G/eEF-2 domains III and V 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P13639
Sequence length 858
Comment (sp|P13639|EF2_HUMAN) Elongation factor 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EEF2; OC=Catarrhini; Hominidae; Homo.
Sequence
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG
EGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV
FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN
ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP
MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK
RKGLKEGIPALDNFLDKL
Download sequence
Identical sequences A0A2J8SBP5 G3RAS9 H2QF02 P13639 Q5R8Z3
ENSPPYP00000010534 ENSPPYP00000010534 NP_001952.1.87134 NP_001952.1.92137 XP_003819315.1.60992 XP_004059791.1.27298 XP_016790164.1.37143 ENSP00000307940 ENSGGOP00000012557 HR3401 gi|4503483|ref|NP_001952.1| ENSP00000307940 9600.ENSPPYP00000010534 9606.ENSP00000307940 ENSGGOP00000012557 4v6x_Az ENSP00000307940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]