SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P13798 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P13798
Domain Number 1 Region: 480-731
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.28e-58
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.0019
Further Details:      
 
Domain Number 2 Region: 60-105,133-165,214-426
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.00000000000000107
Family Prolyl oligopeptidase, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P13798
Sequence length 732
Comment (sp|P13798|ACPH_HUMAN) Oxidized protein hydrolase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=APEH; OC=Catarrhini; Hominidae; Homo.
Sequence
MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDLERMEN
IRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQF
LEVWEKNRKLKSFNLSALEKHGPVYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTK
ALDVSASDDEIARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGV
PENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSL
AVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPRQLGENFSGIY
CSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLM
VAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYA
GLDFEAILLQPGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGS
TGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQY
PETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCLPDLSVWAEMLDKSPIRYI
PQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFM
NAVLWLRTHLGS
Download sequence
Identical sequences A0A024R2U9 P13798
ENSP00000296456 ENSP00000296456 gi|23510451|ref|NP_001631.3| 9606.ENSP00000296456 NP_001631.3.87134 NP_001631.3.92137 XP_011531962.1.92137 400293 HR5580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]