SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P15408 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P15408
Domain Number 1 Region: 126-184
Classification Level Classification E-value
Superfamily Leucine zipper domain 9.38e-21
Family Leucine zipper domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) P15408
Sequence length 326
Comment (sp|P15408|FOSL2_HUMAN) Fos-related antigen 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FOSL2; OC=Catarrhini; Hominidae; Homo.
Sequence
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
EFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDK
AQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL
Download sequence
Identical sequences K7B2D4 P15408
ENSP00000264716 9598.ENSPTRP00000020241 9606.ENSP00000264716 ENSP00000368939 HR3160 ENSP00000264716 gi|4885245|ref|NP_005244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]