SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P15927 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P15927
Domain Number 1 Region: 45-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-43
Family Single strand DNA-binding domain, SSB 0.000000355
Further Details:      
 
Domain Number 2 Region: 203-269
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.82e-20
Family C-terminal domain of RPA32 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P15927
Sequence length 270
Comment (sp|P15927|RFA2_HUMAN) Replication protein A 34 kDa subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPA2; OC=Catarrhini; Hominidae; Homo.
Sequence
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Download sequence
Identical sequences P15927
ENSP00000363021 gi|4506585|ref|NP_002937.1| 2pi2.A 2pi2.B 2pi2.C 2pi2.D 2z6k.A 2z6k.B ENSPANP00000005908 2pi2A 9606.ENSP00000363021 ENSP00000363021 NP_002937.1.87134 NP_002937.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]