SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P15927 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P15927
Domain Number 1 Region: 45-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-43
Family Single strand DNA-binding domain, SSB 0.000000355
Further Details:      
 
Domain Number 2 Region: 203-269
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.82e-20
Family C-terminal domain of RPA32 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.182 53.06
replication fork 2.213 37.25
nucleoplasm part 1.369 33.64
cytoplasmic vesicle part 1.417 32.5
endosome 1.351 32.5
endosome membrane 1.934 32.5
chromosomal region 1.996 30.26
protein-DNA complex 1.923 25.92
aminoacyl-tRNA synthetase multienzyme complex 2.213 25.16
nuclear chromosome part 1.842 24
Biological Process IC (bits) H-Score
DNA replication 2.045 46.08
DNA repair 1.506 40.87
translation 1.514 38.45
telomere organization 2.237 26.52
forebrain development 1.469 20.4
cell-cell signaling 1.346 20.04
digestive tract development 2.033 20.04
RNA biosynthetic process 1.544 19.66
protein localization to organelle 1.552 19.18
regulation of cellular catabolic process 1.475 18.08

Protein sequence

External link(s) P15927
Sequence length 270
Comment (sp|P15927|RFA2_HUMAN) Replication protein A 34 kDa subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPA2; OC=Catarrhini; Hominidae; Homo.
Sequence
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Download sequence
Identical sequences A0A096N0W8 P15927
2pi2A ENSP00000363021 9606.ENSP00000363021 ENSPANP00000005908 2pi2.A 2pi2.B 2pi2.C 2pi2.D 2z6k.A 2z6k.B gi|4506585|ref|NP_002937.1| ENSP00000363021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]