SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P16220 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16220
Domain Number 1 Region: 285-336
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000000000162
Family Leucine zipper domain 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P16220
Sequence length 341
Comment (sp|P16220|CREB1_HUMAN) Cyclic AMP-responsive element-binding protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CREB1; OC=Catarrhini; Hominidae; Homo.
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
Download sequence
Identical sequences A0A096MS95 A0A0D9RCK8 A0A287AVH0 A0A2I2YCF6 A0A2K5I9K2 A0A2K5MQP0 A0A2K5YUX5 A0A2K6BKD0 A0A2K6MDT5 A0A2K6Q2B5 D2H8G8 E2QWQ1 F6Z7F5 G1PTV7 G1R662 G1SNW9 G3TAZ1 G7PLA3 H2P8F2 H2R2Y2 I3MRM5 M3W964 P16220 Q5U0J5 S7N6N9
ENSGGOP00000027520 ENSLAFP00000011090 ENSMLUP00000014684 ENSMMUP00000029753 ENSOCUP00000004708 ENSCAFP00000019912 HR3140 ENSP00000387699 ENSNLEP00000008684 ENSOCUP00000004708 ENSPTRP00000044616 ENSGGOP00000027520 ENSPANP00000002656 ENSAMEP00000015976 ENSMMUP00000029754 ENSPTRP00000044616 ENSNLEP00000008684 9544.ENSMMUP00000029753 9598.ENSPTRP00000044616 9600.ENSPPYP00000014658 9606.ENSP00000387699 9986.ENSOCUP00000004708 ENSP00000387699 ENSCAFP00000019912 ENSLAFP00000011090 NP_001248049.1.72884 NP_604391.1.87134 NP_604391.1.92137 XP_002712648.1.1745 XP_002918133.1.58354 XP_003254044.1.23891 XP_003406152.1.64505 XP_003820856.1.60992 XP_004378331.1.4749 XP_004405459.1.74151 XP_004653599.1.11716 XP_004674403.1.23501 XP_005335173.1.77405 XP_005574143.1.63531 XP_005874279.1.60319 XP_006082510.1.53796 XP_006182191.1.101512 XP_006205288.1.17985 XP_006733437.1.47382 XP_006759491.1.95426 XP_007964216.1.81039 XP_007964217.1.81039 XP_008143453.1.99482 XP_008257269.1.1745 XP_008257270.1.1745 XP_008685652.1.72690 XP_008844412.1.79516 XP_008972512.1.60992 XP_010384370.1.97406 XP_010958399.1.22495 XP_011283812.1.62641 XP_011508947.1.92137 XP_011716188.1.29376 XP_011805235.1.43180 XP_011849285.1.47321 XP_011903095.1.92194 XP_012582030.1.23501 XP_012607534.1.48125 XP_013218240.1.77405 XP_013966465.1.84170 XP_013966466.1.84170 XP_014317541.1.53796 XP_014317546.1.53796 XP_014317553.1.53796 XP_014317557.1.53796 XP_014401567.1.60319 XP_014401568.1.60319 XP_014401569.1.60319 XP_014401570.1.60319 XP_014439808.1.99106 XP_014918775.1.86478 XP_014966217.1.72884 XP_015336796.1.40921 XP_015396460.1.5354 XP_015416602.1.95426 XP_016805866.1.37143 XP_017744857.1.44346 XP_017744858.1.44346 XP_017744859.1.44346 XP_018878075.1.27298 XP_019301772.1.44245 XP_019301773.1.44245 XP_019301774.1.44245 XP_019582472.1.88060 XP_020027823.1.5219 XP_020930963.1.46622 XP_020930965.1.46622 gi|19745184|ref|NP_604391.1| ENSMLUP00000014684 ENSPPYP00000014658 ENSAMEP00000015976 ENSP00000363518 ENSPPYP00000014658 ENSFCAP00000007617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]