SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P16220 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16220
Domain Number 1 Region: 285-336
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000000000162
Family Leucine zipper domain 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) P16220
Sequence length 341
Comment (sp|P16220|CREB1_HUMAN) Cyclic AMP-responsive element-binding protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CREB1; OC=Catarrhini; Hominidae; Homo.
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
Download sequence
Identical sequences A0A096MS95 A0A0D9RCK8 D2H8G8 E2QWQ1 F6Z7F5 G1PTV7 G1R662 G1SNW9 G3SHD2 G3TAZ1 G7PLA3 H2P8F2 H2R2Y2 M3W964 P16220 Q5U0J5 S7N6N9
ENSMMUP00000029754 ENSLAFP00000011090 ENSPPYP00000014658 ENSOCUP00000004708 ENSGGOP00000027520 ENSNLEP00000008684 ENSAMEP00000015976 gi|19745184|ref|NP_604391.1| ENSCAFP00000019912 ENSOCUP00000004708 HR3140 ENSPTRP00000044616 9544.ENSMMUP00000029753 9598.ENSPTRP00000044616 9600.ENSPPYP00000014658 9606.ENSP00000387699 9986.ENSOCUP00000004708 ENSAMEP00000015976 ENSPTRP00000044616 ENSFCAP00000007617 ENSLAFP00000011090 ENSP00000387699 ENSPPYP00000014658 ENSMMUP00000029753 ENSP00000387699 ENSPANP00000002656 ENSP00000363518 ENSMLUP00000014684 ENSNLEP00000008684 ENSMLUP00000014684 ENSCAFP00000019912 ENSGGOP00000027520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]