SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P16284 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16284
Domain Number 1 Region: 500-593
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000663
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 40-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000474
Family I set domains 0.055
Further Details:      
 
Domain Number 3 Region: 332-405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000199
Family I set domains 0.059
Further Details:      
 
Domain Number 4 Region: 234-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000231
Family I set domains 0.062
Further Details:      
 
Domain Number 5 Region: 408-496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000287
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P16284
Sequence length 738
Comment (sp|P16284|PECA1_HUMAN) PECA1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PECAM1; OC=Catarrhini; Hominidae; Homo.
Sequence
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT
Download sequence
Identical sequences P16284
ENSP00000457421 ENSP00000455663 NP_000433.4.87134 NP_000433.4.92137 XP_011523191.1.92137 XP_011523192.1.92137 XP_016880227.1.92137 gi|313760624|ref|NP_000433.4| ENSP00000457421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]