SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P16949 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16949
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily Stathmin 5.62e-59
Family Stathmin 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
neuromuscular junction 1.958 29.6
site of polarized growth 1.648 11.89
microtubule cytoskeleton 1.44 10.6
cell leading edge 1.426 9.93
cell body 1.534 7.6
Molecular Function IC (bits) H-Score
tubulin binding 1.711 27.57

Protein sequence

External link(s) P16949
Sequence length 149
Comment (sp|P16949|STMN1_HUMAN) pp17 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=STMN1; OC=Catarrhini; Hominidae; Homo.
Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHIEEVRKNKESKDPADETEAD
Download sequence
Identical sequences A0A096MZ01 A0A0D9S860 A0A1S2ZPN4 A9YWH3 F6Z5N6 F7IA67 G1PGN2 G1RD61 G3S1A3 H0WK20 H2N8H6 I0FRN2 J9NVP2 K7BI32 M3WVG9 P16949 Q25QD1 Q3T0C7 Q4R712 Q6DUB7 W5P6X5
ENSPANP00000005185 ENSBTAP00000018284 ENSNLEP00000011160 ENSCAFP00000037234 ENSPPYP00000001965 ENSOGAP00000001885 ENSGGOP00000021848 ENSTTRP00000011853 ENSSSCP00000021642 ENSP00000350531 ENSP00000363409 ENSP00000382633 ENSP00000387858 ENSCAFP00000037234 ENSTTRP00000011853 ENSFCAP00000018356 ENSEEUP00000008514 gi|44890050|ref|NP_981944.1| gi|44890052|ref|NP_981946.1| gi|5031851|ref|NP_005554.1| ENSMLUP00000009804 ENSECAP00000019130 ENSECAP00000019130 ENSBTAP00000018284 ENSEEUP00000008514 ENSCJAP00000017366 ENSCJAP00000044261 ENSCJAP00000046483 ENSMLUP00000009804 ENSP00000350531 ENSP00000363409 ENSP00000382633 ENSP00000387858 ENSOGAP00000001885 ENSPPYP00000001965 HR6425 9598.ENSPTRP00000000653 9615.ENSCAFP00000030444 9796.ENSECAP00000019130 9913.ENSBTAP00000018284 ENSVPAP00000001131 ENSSSCP00000021642 ENSVPAP00000001131 ENSOARP00000006179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]