SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P16949 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16949
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily Stathmin 5.62e-59
Family Stathmin 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P16949
Sequence length 149
Comment (sp|P16949|STMN1_HUMAN) pp17 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=STMN1; OC=Catarrhini; Hominidae; Homo.
Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHIEEVRKNKESKDPADETEAD
Download sequence
Identical sequences A0A096MZ01 A0A0D9S860 A0A1S2ZPN4 A0A2F0AVY6 A0A2K5DVU8 A0A2K5KW10 A0A2K5QXN1 A0A2K5ZG81 A0A2K6E7E1 A0A2K6L553 A0A2K6NKF9 A0A2K6U086 A9YWH3 F6Z5N6 F7IA67 G1PGN2 G1RD61 G3S1A3 H0WK20 H2N8H6 I0FRN2 J9NVP2 K7BI32 M3WVG9 P16949 Q25QD1 Q3T0C7 Q4R712 Q6DUB7 W5P6X5
HR6425 ENSMLUP00000009804 ENSCAFP00000037234 ENSFCAP00000018356 ENSEEUP00000008514 ENSECAP00000019130 ENSSSCP00000021642 ENSSSCP00000021642 ENSMLUP00000009804 ENSECAP00000019130 ENSOGAP00000001885 ENSNLEP00000011160 ENSOARP00000006179 ENSPANP00000005185 ENSOGAP00000001885 ENSTTRP00000011853 ENSEEUP00000008514 ENSP00000350531 ENSP00000363409 ENSP00000382633 ENSP00000387858 ENSVPAP00000001131 NP_001009582.1.46622 NP_001029962.1.59421 NP_001029962.1.76553 NP_001296337.1.31192 NP_005554.1.87134 NP_005554.1.92137 NP_981944.1.87134 NP_981944.1.92137 NP_981946.1.87134 NP_981946.1.92137 XP_001136848.1.37143 XP_001137168.1.37143 XP_002802292.1.72884 XP_002913339.1.58354 XP_003271681.1.23891 XP_003271682.1.23891 XP_003733422.1.60252 XP_003775816.1.23681 XP_003799828.1.62490 XP_003799832.1.62490 XP_003809518.1.60992 XP_003809520.1.60992 XP_003934880.1.74449 XP_003989723.1.62641 XP_004005152.1.66739 XP_004025257.1.27298 XP_004266708.1.21590 XP_004266709.1.21590 XP_004321749.1.83887 XP_004321750.1.83887 XP_004377150.1.4749 XP_004394778.1.74151 XP_004394779.1.74151 XP_004425814.1.5094 XP_004450575.1.11602 XP_005203304.1.76553 XP_005544434.1.63531 XP_005607385.1.31192 XP_005665169.1.46622 XP_005665171.1.46622 XP_005676884.1.57651 XP_005875229.1.60319 XP_005875230.1.60319 XP_005875231.1.60319 XP_005895924.1.15283 XP_006055487.1.26621 XP_006102030.1.53796 XP_006102031.1.53796 XP_006102032.1.53796 XP_006189563.1.101512 XP_006196861.1.17985 XP_006934480.1.62641 XP_007083717.1.5354 XP_007083718.1.5354 XP_007121585.1.24612 XP_007178744.1.59432 XP_007459194.1.90284 XP_007459195.1.90284 XP_007522627.1.11023 XP_007978144.1.81039 XP_008146280.1.99482 XP_008527277.1.77740 XP_008564176.1.73410 XP_008692798.1.72690 XP_008998929.1.60252 XP_008998930.1.60252 XP_008998931.1.60252 XP_008998932.1.60252 XP_010353750.1.97406 XP_010828387.1.44457 XP_010946345.1.22495 XP_010946346.1.22495 XP_010946347.1.22495 XP_010992019.1.51371 XP_010992020.1.51371 XP_011761232.1.29376 XP_011761233.1.29376 XP_011761234.1.29376 XP_011837005.1.47321 XP_011935465.1.92194 XP_011935466.1.92194 XP_011970658.1.54773 XP_011970659.1.54773 XP_012295311.1.9421 XP_012353861.1.23891 XP_012415827.1.74151 XP_012415828.1.74151 XP_012605913.1.48125 XP_012605914.1.48125 XP_014418793.1.101512 XP_014710499.1.49734 XP_014710500.1.49734 XP_014930633.1.86478 XP_014949165.1.66739 XP_014987184.1.72884 XP_014987189.1.72884 XP_015095482.1.17985 XP_015295943.1.63531 XP_015295946.1.63531 XP_015316021.1.76553 XP_015316025.1.76553 XP_015985333.1.101085 XP_016071912.1.3490 XP_016812119.1.37143 XP_016812120.1.37143 XP_017390117.1.71028 XP_017390118.1.71028 XP_017390119.1.71028 XP_017390120.1.71028 XP_017518568.1.32401 XP_017711645.1.44346 XP_017911670.1.57651 XP_018868590.1.27298 XP_018868591.1.27298 XP_019317418.1.44245 XP_019317419.1.44245 XP_019569238.1.88060 XP_019569245.1.88060 XP_019569254.1.88060 XP_019658389.1.58354 XP_019836448.1.53367 XP_019836455.1.53367 XP_020727751.1.74333 XP_020764892.1.74333 XP_020764893.1.74333 XP_535349.1.84170 XP_866126.1.84170 ENSP00000350531 ENSP00000363409 ENSP00000382633 ENSP00000387858 ENSCAFP00000037234 ENSCJAP00000017366 ENSCJAP00000044261 ENSCJAP00000046483 ENSBTAP00000018284 ENSPPYP00000001965 ENSGGOP00000021848 ENSTTRP00000011853 9598.ENSPTRP00000000653 9615.ENSCAFP00000030444 9796.ENSECAP00000019130 9913.ENSBTAP00000018284 ENSVPAP00000001131 gi|44890050|ref|NP_981944.1| gi|44890052|ref|NP_981946.1| gi|5031851|ref|NP_005554.1| ENSBTAP00000018284 ENSPPYP00000001965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]