SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P17568 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P17568
Sequence length 137
Comment (sp|P17568|NDUB7_HUMAN) NADH-ubiquinone oxidoreductase B18 subunit KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NDUFB7; OC=Catarrhini; Hominidae; Homo.
Sequence
MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA
HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAA
ELAKGQGPGEVDPKVAL
Download sequence
Identical sequences P17568
2480 ENSP00000215565 9606.ENSP00000215565 5xtd_v gi|10764847|ref|NP_004137.2| NP_004137.2.87134 NP_004137.2.92137 ENSP00000215565 ENSP00000215565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]