SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P17658 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P17658
Domain Number 1 Region: 173-198,255-462
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-58
Family Voltage-gated potassium channels 0.00061
Further Details:      
 
Domain Number 2 Region: 41-137
Classification Level Classification E-value
Superfamily POZ domain 7.06e-26
Family Tetramerization domain of potassium channels 0.00000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P17658
Sequence length 529
Comment (sp|P17658|KCNA6_HUMAN) Voltage-gated potassium channel subunit Kv1.6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCNA6; OC=Catarrhini; Hominidae; Homo.
Sequence
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEE
IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITP
GEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIID
LVAIFPYFITLGTELVQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSK
GLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHV
TCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV
Download sequence
Identical sequences A0A2I2YQ40 P17658
ENSP00000280684 ENSP00000408321 ENSP00000280684 9606.ENSP00000280684 gi|4504821|ref|NP_002226.1| NP_002226.1.87134 NP_002226.1.92137 XP_004052580.1.27298 XP_005253743.1.92137 XP_011519257.1.92137 XP_016874759.1.92137 XP_016874760.1.92137 XP_016874761.1.92137 XP_018894161.1.27298 XP_018894162.1.27298 XP_018894163.1.27298 ENSP00000280684 ENSP00000408321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]