SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P18065 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P18065
Domain Number 1 Region: 220-310
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.01e-23
Family Thyroglobulin type-1 domain 0.00024
Further Details:      
 
Domain Number 2 Region: 39-136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-18
Family Growth factor receptor domain 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P18065
Sequence length 325
Comment (sp|P18065|IBP2_HUMAN) Insulin-like growth factor-binding protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IGFBP2; OC=Catarrhini; Hominidae; Homo.
Sequence
MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAP
PAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELP
LQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKP
LKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIST
MRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
RGDPECHLFYNEQQEARGVHTQRMQ
Download sequence
Identical sequences A0A2K6N8C6 G1R6Q3 H2QJD5 P18065
ENSPTRP00000022056 XP_010360616.1.97406 XP_516234.3.37143 ENSP00000233809 9598.ENSPTRP00000022056 9606.ENSP00000233809 ENSNLEP00000008875 ENSP00000233809 ENSPTRP00000022056 ENSP00000389646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]