SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P18433 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P18433
Domain Number 1 Region: 219-502
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000505
Further Details:      
 
Domain Number 2 Region: 506-792
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P18433
Sequence length 802
Comment (sp|P18433|PTPRA_HUMAN) Receptor-type tyrosine-protein phosphatase alpha KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PTPRA; OC=Catarrhini; Hominidae; Homo.
Sequence
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLS
VAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEP
WEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKL
FREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASF
INGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGM
LKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQ
RCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQK
DSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITV
ELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQ
YEFCYKVVQEYIDAFSDYANFK
Download sequence
Identical sequences P18433
ENSP00000369756 ENSP00000382787 ENSP00000369756 ENSP00000382787 9606.ENSP00000369756 gi|4506303|ref|NP_002827.1| NYSGXRC-8610a NP_002827.1.87134 NP_002827.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]