SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P18847 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P18847
Domain Number 1 Region: 89-146
Classification Level Classification E-value
Superfamily Leucine zipper domain 3.19e-18
Family Leucine zipper domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P18847
Sequence length 181
Comment (sp|P18847|ATF3_HUMAN) Activating transcription factor 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ATF3; OC=Catarrhini; Hominidae; Homo.
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S
Download sequence
Identical sequences A0A2K5F1D5 G1QRJ9 G3RE79 K7D430 P18847
ENSP00000344352 ENSP00000355954 HR4572 NP_001025458.1.87134 NP_001025458.1.92137 NP_001665.1.87134 NP_001665.1.92137 XP_003273102.1.23891 XP_003273105.1.23891 XP_004028416.1.27298 XP_005273203.1.92137 XP_011507881.1.92137 XP_012315037.1.9421 XP_012315038.1.9421 XP_012362230.1.23891 XP_016793872.1.37143 XP_016793874.1.37143 XP_016793877.1.37143 XP_018885931.1.27298 XP_018885934.1.27298 9598.ENSPTRP00000051186 9606.ENSP00000344352 ENSP00000344352 ENSGGOP00000013856 gi|4502263|ref|NP_001665.1| gi|71902536|ref|NP_001025458.1| ENSNLEP00000003567 ENSP00000344352 ENSP00000355954 ENSGGOP00000013856 ENSNLEP00000003567 ENSNLEP00000024214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]