SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P19086 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P19086
Domain Number 1 Region: 30-57,175-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.8e-59
Family G proteins 0.000000189
Further Details:      
 
Domain Number 2 Region: 61-179
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 9.55e-34
Family Transducin (alpha subunit), insertion domain 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P19086
Sequence length 355
Comment (sp|P19086|GNAZ_HUMAN) Gz-alpha KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GNAZ; OC=Catarrhini; Hominidae; Homo.
Sequence
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEA
AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
Download sequence
Identical sequences A0A096NRB0 A0A0D9RNH6 A0A2J8RZ48 A0A2K5CPJ0 A0A2K5J1J6 A0A2K5KHT8 A0A2K5Q7Y6 A0A2K5WQN4 A0A2K5ZA32 A0A2K6DU18 A0A2K6KAN6 A0A2K6NW28 A0A2K6SV48 F7GJC8 F7I574 G1RZV9 G3RJV2 H2QLC1 P19086
ENSPTRP00000024336 ENSNLEP00000018786 NP_001248525.1.72884 NP_002064.1.87134 NP_002064.1.92137 XP_002743656.1.60252 XP_003280859.1.23891 XP_003938588.1.74449 XP_004063181.1.27298 XP_005567864.1.63531 XP_005567865.1.63531 XP_007973064.1.81039 XP_010374600.1.97406 XP_011768974.1.29376 XP_011768976.1.29376 XP_011811739.1.43180 XP_011811742.1.43180 XP_011844567.1.47321 XP_011844568.1.47321 XP_011944906.1.92194 XP_011944907.1.92194 XP_012296166.1.9421 XP_015005249.1.72884 XP_016795016.1.37143 XP_017374973.1.71028 XP_017745264.1.44346 XP_017745265.1.44346 ENSP00000478892 ENSPANP00000015580 ENSMMUP00000002367 9544.ENSMMUP00000002367 9598.ENSPTRP00000024336 9606.ENSP00000248996 ENSNLEP00000018786 gi|4504051|ref|NP_002064.1| ENSCJAP00000043892 ENSP00000248996 ENSCJAP00000017946 ENSP00000248996 ENSPTRP00000024336 ENSMMUP00000002367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]