SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P19256 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P19256
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000517
Family V set domains (antibody variable domain-like) 0.00000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P19256
Sequence length 250
Comment (sp|P19256|LFA3_HUMAN) Surface glycoprotein LFA-3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CD58; OC=Catarrhini; Hominidae; Homo.
Sequence
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYV
LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMEND
LPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKC
DRKPDRTNSN
Download sequence
Identical sequences P19256
ENSP00000358499 9606.ENSP00000358501 gi|4502677|ref|NP_001770.1| NP_001770.1.87134 NP_001770.1.92137 ENSP00000358501 ENSP00000358501 NYSGRC-IgSF-LFA3_HUMAN OPTIC1668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]