SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P20264 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P20264
Domain Number 1 Region: 315-388
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.13e-31
Family POU-specific domain 0.00012
Further Details:      
 
Domain Number 2 Region: 403-465
Classification Level Classification E-value
Superfamily Homeodomain-like 7.7e-17
Family Homeodomain 0.00037
Further Details:      
 
Weak hits

Sequence:  P20264
Domain Number - Region: 139-144
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P20264
Sequence length 500
Comment (sp|P20264|PO3F3_HUMAN) Octamer-binding transcription factor 8 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=POU3F3; OC=Catarrhini; Hominidae; Homo.
Sequence
MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGGAGGGGGGMQPGSAAVTS
GAYRGDPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASS
PWSGSAVGMAGSPQQPPQPPPPPPQGPDVKGGAGRDDLHAGTALHHRGPPHLGPPPPPPH
QGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGP
GGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGGG
AGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTI
CRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGA
LESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQ
VGTVSADTPPPHHGLQTSVQ
Download sequence
Identical sequences A0A2J8S9J1 P20264
ENSP00000355001 ENSP00000355001 NP_006227.1.87134 NP_006227.1.92137 ENSP00000355001 gi|5453936|ref|NP_006227.1| 9606.ENSP00000355001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]