SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P20292 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P20292
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily MAPEG domain-like 3.53e-37
Family MAPEG domain 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear envelope 1.891 11.37
organelle envelope 1.405 10.88
outer membrane 2.091 6.17
endoplasmic reticulum subcompartment 1.59 4.71

Protein sequence

External link(s) P20292
Sequence length 161
Comment (sp|P20292|AL5AP_HUMAN) MK-886-binding protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALOX5AP; OC=Catarrhini; Hominidae; Homo.
Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Download sequence
Identical sequences G3RDC2 H2Q7D6 P20292
NP_001620.2 XP_016780609.1 ENSPTRP00000009797 ENSP00000369858 ENSGGOP00000013521 ENSP00000369858 ENSP00000369858 ENSPTRP00000009797 gi|15718675|ref|NP_001620.2| 9598.ENSPTRP00000009797 9606.ENSP00000369858 ENSGGOP00000013521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]