SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P20592 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P20592
Domain Number 1 Region: 95-397
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.91e-69
Family G proteins 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P20592
Sequence length 715
Comment (sp|P20592|MX2_HUMAN) p78-related protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MX2; OC=Catarrhini; Hominidae; Homo.
Sequence
MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLA
KDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPA
IAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELEL
QDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRD
IGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMD
RGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFFQTHPYFRVLL
EEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMF
FLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEEV
EKYEKQYRGKELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFG
EFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPL
GTPSQNMKLNSHFPSNESSVSSFTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDS
LQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLTQARHALCQFSSKEIH
Download sequence
Identical sequences P20592
9606.ENSP00000333657 NP_002454.1.87134 NP_002454.1.92137 XP_005261040.1.92137 XP_005261041.1.92137 XP_011527873.1.92137 XP_011527874.1.92137 ENSP00000333657 gi|11342664|ref|NP_002454.1| ENSP00000333657 ENSP00000333657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]