SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P21589 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P21589
Domain Number 1 Region: 28-332
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1e-90
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00000169
Further Details:      
 
Domain Number 2 Region: 337-548
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.14e-55
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P21589
Sequence length 574
Comment (sp|P21589|5NTD_HUMAN) Ecto-5'-nucleotidase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NT5E; OC=Catarrhini; Hominidae; Homo.
Sequence
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR
VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYP
AVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ
Download sequence
Identical sequences P21589
gi|4505467|ref|NP_002517.1| ENSP00000257770 9606.ENSP00000257770 NYSGXRC-8644a ENSP00000257770 NP_002517.1.87134 NP_002517.1.92137 ENSP00000257770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]