SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P23083 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P23083
Domain Number 1 Region: 20-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-47
Family V set domains (antibody variable domain-like) 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P23083
Sequence length 117
Comment (sp|P23083|HV102_HUMAN) Ig heavy chain V-I region V35 {ECO:0000305|PubMed:2841108} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IGHV1-2 OC=Catarrhini; Hominidae; Homo.
Sequence
MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAP
GQGLEWMGWINPNSGGTNYAQKFQGWVTMTRDTSISTAYMELSRLRSDDTAVYYCAR
Download sequence
Identical sequences P23083
ENSP00000473848 ENSP00000375003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]